Skip to content 
99.0% pure
View Janoshik Certificate of analysis (COA) here
- Home
- IGF1-LR3 1MG
IGF1-LR3 1MG
£59.99
Availability: 23 in stock
Availability: 23 in stock
- Research Use Only
Used solely for in vitro experiments and cannot be:
- Used in clinical trials involving humans.
- Administered to humans as part of an experiment or investigation.
- Supplied to another party for human investigational use.
SKU: IGF1
Technical Specifications
- Purity: ≥99% (HPLC Verified)
- Format: Lyophilized White powder
- Storage: Refrigerate at 2°C – 8°C and protect from direct light and moisture to prevent degradation.
Legal Disclaimer: This product is intended for laboratory research purposes only. It is not for human, clinical, or veterinary use. All researchers must handle this compound according to standard laboratory safety protocols
Description
Chemical identity
- Amino acid sequence (N- to C-terminus):
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
(83 residues) - Structural modifications relative to mature human IGF-1 (70 residues):
- 13-residue N-terminal extension: Met-Phe-Pro-Ala-Met-Pro-Leu-Ser-Ser-Leu-Phe-Val-Asn
- Glu³ → Arg substitution in the B-domain of the IGF-1 core
- Disulfide bonds: Three intramolecular disulfides (corresponding to the native Cys⁶–Cys⁴⁸, Cys⁴⁷–Cys⁵² and Cys¹⁸–Cys⁶¹ pairings)
- Molecular formula: C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉ (reduced form; oxidized form differs by loss of 6 H)
- Molecular weight: approximately 9112–9118 Da
